PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109249.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Nin-like
Protein Properties Length: 263aa    MW: 30971.4 Da    PI: 6.2444
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109249.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.53.4e-25155203452
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     e++ ed++kyF+lpik+AAkeLgv++T LK++CR++ I RWPhRk ksl
  XP_010109249.1 155 ELESEDIQKYFDLPIKEAAKELGVGVTRLKKRCRELKITRWPHRKFKSL 203
                     7999*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.018137225IPR003035RWP-RK domain
PfamPF020421.5E-22156203IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MDYYSAQINL PQIEDYPLDF DWLYYDQQPF ENLLLDFPPV QSTFLEPNFL PLWSHNYGHQ  60
LPCIDFQDFE DFGGVFSLEI DNAFTHPNCE DTIVDEKPQT NLVTSFHHYN HHDMINIPSS  120
TDQLCSEVVP KMIIERKIIG STKSGKIGNY EKFSELESED IQKYFDLPIK EAAKELGVGV  180
TRLKKRCREL KITRWPHRKF KSLKYLISNV KKMGLDGNEI RMLEEHKRLL EEVPDMELTE  240
KTKKLRQACF KANYKNKRSL ARV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109249.10.0hypothetical protein L484_011871
TrEMBLW9SCI30.0W9SCI3_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-39RWP-RK domain-containing protein